PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2874_p5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 297aa    MW: 33418.9 Da    PI: 5.0687
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2874_p5genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.99.8e-082872345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +WT eE +++ +a + + ++   +W ++a++++ g+t  +++  + 
       RrC2874_p5 28 KWTHEENKKFENALAYYDKDtpdRWYKVAAMLP-GKTVGDVIKQYK 72
                     8********************************.****99988775 PP

2Myb_DNA-binding48.61.9e-15140184347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
       RrC2874_p5 140 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 184
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-42373IPR009057Homeodomain-like
PROSITE profilePS512938.7892477IPR017884SANT domain
SMARTSM007171.9E-82577IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-112779IPR009057Homeodomain-like
CDDcd001673.84E-62874No hitNo description
PfamPF002492.1E-62872IPR001005SANT/Myb domain
PROSITE profilePS5129421.845133189IPR017930Myb domain
SuperFamilySSF466891.66E-17135188IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-18136188IPR006447Myb domain, plants
SMARTSM007178.7E-14137187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-13137184IPR009057Homeodomain-like
CDDcd001672.75E-11140185No hitNo description
PfamPF002497.7E-13140184IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MYRGIQVMSP ATYLDTSNWL FQENKGTKWT HEENKKFENA LAYYDKDTPD RWYKVAAMLP  60
GKTVGDVIKQ YKELEEDLSD IEAGLIPIPG YASDSFTLDW GGYDAGNNGF DMNGYYFAAA  120
GGKRGSAARA AEHERKKGVP WTEEEHRQFL MGLKKYGKGD WRNIARNFVT TRTPTQVASH  180
AQKYFIRQVN GGKDKRRSSI HDITTVNIPD SPDAAATDTA TANTPCSPPS VGGSQWEASD  240
QWEGQTTYDE TAAAFYNQNA FQETLLEMSS TPYMAKLQEQ SFLNASQFES YNAYLQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-162693875RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1181350.0AK118135.1 Arabidopsis thaliana At2g38090 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL19-43-J04.
GenBankAY5195290.0AY519529.1 Arabidopsis thaliana MYB transcription factor (At2g38090) mRNA, complete cds.
GenBankBT0061220.0BT006122.1 Arabidopsis thaliana clone U50930 putative MYB family transcription factor (At2g38090) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294698.10.0hypothetical protein CARUB_v10023736mg
SwissprotQ8S9H71e-93DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0FXY90.0R0FXY9_9BRAS; Uncharacterized protein
STRINGBra000038.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.10.0MYB family protein